IFI30 (NM_006332) Human Recombinant Protein
CAT#: TP305877L
Purified recombinant protein of Homo sapiens interferon, gamma-inducible protein 30 (IFI30), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205877 protein sequence
Red=Cloning site Green=Tags(s) MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006323 |
| Locus ID | 10437 |
| UniProt ID | P13284 |
| Refseq Size | 1034 |
| Cytogenetics | 19p13.11 |
| Refseq ORF | 750 |
| Synonyms | GILT; IFI-30; IP-30; IP30 |
| Summary | The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Antigen processing and presentation |
Documents
| FAQs |
| SDS |
