TRF1 (TERF1) (NM_003218) Human Recombinant Protein
CAT#: TP305904
Recombinant protein of human telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 2, 20 µg
View other "TRF1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205904 protein sequence
Red=Cloning site Green=Tags(s) MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEA EAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDA QFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPF KSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSG NDVEMETEANLDTRKRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPV TPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003209 |
| Locus ID | 7013 |
| UniProt ID | P54274 |
| Refseq Size | 2900 |
| Cytogenetics | 8q21.11 |
| Refseq ORF | 1257 |
| Synonyms | hTRF1-AS; PIN2; t-TRF1; TRBF1; TRF; TRF1 |
| Summary | This gene encodes a telomere specific protein which is a component of the telomere nucleoprotein complex. This protein is present at telomeres throughout the cell cycle and functions as an inhibitor of telomerase, acting in cis to limit the elongation of individual chromosome ends. The protein structure contains a C-terminal Myb motif, a dimerization domain near its N-terminus and an acidic N-terminus. Two transcripts of this gene are alternatively spliced products. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413770 | TERF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC418833 | TERF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413770 | Transient overexpression lysate of telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 1 |
CNY 4840.00 |
|
| LY418833 | Transient overexpression lysate of telomeric repeat binding factor (NIMA-interacting) 1 (TERF1), transcript variant 2 |
CNY 3080.00 |
|
| PH305904 | TERF1 MS Standard C13 and N15-labeled recombinant protein (NP_003209) |
CNY 19520.00 |
