HSD17B11 (NM_016245) Human Recombinant Protein
CAT#: TP305941
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11), 20 µg
View other "HSD17B11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205941 representing NM_016245
Red=Cloning site Green=Tags(s) MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINK HGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKT FEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITG VKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAV LKRKISVKFDAVIGYKMKAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057329 |
| Locus ID | 51170 |
| UniProt ID | Q8NBQ5 |
| Refseq Size | 1701 |
| Cytogenetics | 4q22.1 |
| Refseq ORF | 900 |
| Synonyms | 17-BETA-HSD11; 17-BETA-HSDXI; 17BHSD11; DHRS8; PAN1B; RETSDR2; SDR16C2 |
| Summary | Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414088 | HSD17B11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414088 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 11 (HSD17B11) |
CNY 3080.00 |
|
| PH305941 | HSD17B11 MS Standard C13 and N15-labeled recombinant protein (NP_057329) |
CNY 19520.00 |
其它HSD17B11产品
