Metallothionein (MT1A) (NM_005946) Human Recombinant Protein

CAT#: TP305942

Recombinant protein of human metallothionein 1A (MT1A), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "Metallothionein" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00

CNY 6650.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC205942 protein sequence
Red=Cloning site Green=Tags(s)

MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCCA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 5.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_005937
Locus ID 4489
UniProt ID P04731
Refseq Size 468
Cytogenetics 16q13
Refseq ORF 183
Synonyms MT-1A; MT-IA; MT1; MT1S; MTC
Summary This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. The conserved cysteine residues co-ordinate metal ions using mercaptide linkages. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. Disruption of two metallothionein genes in mouse resulted in defects in protection against heavy metals, oxidative stress, immune reactions, carcinogens, and displayed obesity. [provided by RefSeq, Sep 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...