SMRP1 (C9orf24) (NM_032596) Human Recombinant Protein
CAT#: TP305959
Recombinant protein of human chromosome 9 open reading frame 24 (C9orf24), transcript variant 1, 20 µg
View other "SMRP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205959 protein sequence
Red=Cloning site Green=Tags(s) MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEALQKMAKCAVQD YTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAV RGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITPRCGCVDPLPGRLPFHGYESACSGRHYCLRG MDYYASGAPCTDRRLRPWCREQQTMCTSLRAPARNAVCCYNSPAVILPISEP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115985 |
| Locus ID | 84688 |
| UniProt ID | Q8NCR6 |
| Refseq Size | 1184 |
| Cytogenetics | 9p13.3 |
| Refseq ORF | 786 |
| Synonyms | bA573M23.4; CBE1; NYD-SP22; SMRP1 |
| Summary | This gene encodes a nuclear- or perinuclear-localized protein with no predicted domains or similarity to other known proteins. Expression of this gene is induced during the differentiation of bronchial epithelial cells, and the encoded protein may play a role in ciliogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410011 | C9orf24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410011 | Transient overexpression lysate of chromosome 9 open reading frame 24 (C9orf24), transcript variant 1 |
CNY 3080.00 |
|
| PH305959 | C9orf24 MS Standard C13 and N15-labeled recombinant protein (NP_115985) |
CNY 19520.00 |
