GFM2 (NM_032380) Human Recombinant Protein
CAT#: TP305962
Recombinant protein of human G elongation factor, mitochondrial 2 (GFM2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "GFM2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205962 protein sequence
Red=Cloning site Green=Tags(s) MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSIHSIINPPIAKI RNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYRVNLI DTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRICFLNKMDKTGASFKYAVES IREKLKAKPLLLQLPIGEAKTFKGVVDVVMKEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNAL IEQVADLDDEFADLVLEEFSENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLP SPEERNYEFLQWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQ HVEIHSLTAGNIALTVGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLLAGVEIPEPVF FCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPL QVAYRETILNSVRATDTLDRTLGDKRHLVTVEVGARPIETSSVMPVIEYAESINEGLLKVSQEAIENGIH SACLQGPLLGSPIQDVAITLHSLTIHPGTSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLS PVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAGIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNTLL NRRSGLT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 86.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115756 |
Locus ID | 84340 |
UniProt ID | Q969S9 |
Refseq Size | 3264 |
Cytogenetics | 5q13.3 |
Refseq ORF | 2331 |
Synonyms | EF-G2mt; EFG2; hEFG2; mEF-G 2; MRRF2; MST027; MSTP027; RRF; RRF2; RRF2mt |
Summary | Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of the mitochondrial translation elongation factors, which is a GTPase that plays a role at the termination of mitochondrial translation by mediating the disassembly of ribosomes from messenger RNA . Its role in the regulation of normal mitochondrial function and in disease states attributed to mitochondrial dysfunction is not known. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406908 | GFM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC410173 | GFM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406908 | Transient overexpression lysate of G elongation factor, mitochondrial 2 (GFM2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 4840.00 |
|
LY410173 | Transient overexpression lysate of G elongation factor, mitochondrial 2 (GFM2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
PH305962 | GFM2 MS Standard C13 and N15-labeled recombinant protein (NP_115756) |
CNY 19520.00 |