STK38L (NM_015000) Human Recombinant Protein
CAT#: TP306074
Recombinant protein of human serine/threonine kinase 38 like (STK38L), 20 µg
View other "STK38L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206074 protein sequence
Red=Cloning site Green=Tags(s) MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH ARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD ILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI HRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA YSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI SEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 53.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | In vitro kinase assay substrate (PMID: 28689759) |
| Reference Data | |
| RefSeq | NP_055815 |
| Locus ID | 23012 |
| UniProt ID | Q9Y2H1 |
| Refseq Size | 5110 |
| Cytogenetics | 12p11.23 |
| Refseq ORF | 1392 |
| Synonyms | NDR2 |
| Summary | Involved in the regulation of structural processes in differentiating and mature neuronal cells.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Protein Kinase |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Amplification of F-Actin Disassembly and Cellular Repulsion by Growth Factor Signaling
,Yoon, J;Kim, SB;Ahmed, G;Shay, JW;Terman, JR;,
Dev. Cell
,PubMed ID 28689759
[STK38L]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414864 | STK38L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414864 | Transient overexpression lysate of serine/threonine kinase 38 like (STK38L) |
CNY 3080.00 |
|
| PH306074 | STK38L MS Standard C13 and N15-labeled recombinant protein (NP_055815) |
CNY 19520.00 |
