MCM4 (NM_182746) Human Recombinant Protein
CAT＃: TP306122
Recombinant protein of human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, 20 µg
View other "MCM4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206122 protein sequence
Red=Cloning site Green=Tags(s) MSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFS SPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIV ASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNV NCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDID QLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQ MIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIH YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRK DFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQT GALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTT IENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMP RLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALK QSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF EEALRALADDDFLTVTGKTVRLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 96.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_877423 |
| Locus ID | 4173 |
| UniProt ID | P33991 |
| Refseq Size | 4800 |
| Cytogenetics | 8q11.21 |
| Refseq ORF | 2589 |
| Synonyms | CDC21; CDC54; hCdc21; IMD54; NKCD; NKGCD; P1-CDC21 |
| Summary | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Cell cycle, DNA replication |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405345 | MCM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416982 | MCM4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405345 | Transient overexpression lysate of minichromosome maintenance complex component 4 (MCM4), transcript variant 2 |
CNY 3080.00 |
|
| LY416982 | Transient overexpression lysate of minichromosome maintenance complex component 4 (MCM4), transcript variant 1 |
CNY 3080.00 |
|
| PH306122 | MCM4 MS Standard C13 and N15-labeled recombinant protein (NP_877423) |
CNY 19520.00 |
|
| PH312292 | MCM4 MS Standard C13 and N15-labeled recombinant protein (NP_005905) |
CNY 19520.00 |
|
| TP312292 | Recombinant protein of human minichromosome maintenance complex component 4 (MCM4), transcript variant 1, 20 µg |
CNY 2900.00 |
