ELMOD1 (NM_018712) Human Recombinant Protein
CAT#: TP306126
Recombinant protein of human ELMO/CED-12 domain containing 1 (ELMOD1), transcript variant 1, 20 µg
View other "ELMOD1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206126 protein sequence
Red=Cloning site Green=Tags(s) MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSV SVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLK LWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDI TKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYL MHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_061182 |
| Locus ID | 55531 |
| UniProt ID | Q8N336 |
| Refseq Size | 3006 |
| Cytogenetics | 11q22.3 |
| Refseq ORF | 1002 |
| Summary | Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412885 | ELMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427120 | ELMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412885 | Transient overexpression lysate of ELMO/CED-12 domain containing 1 (ELMOD1), transcript variant 1 |
CNY 3080.00 |
|
| LY427120 | Transient overexpression lysate of ELMO/CED-12 domain containing 1 (ELMOD1), transcript variant 2 |
CNY 3080.00 |
|
| PH306126 | ELMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_061182) |
CNY 19520.00 |
