ARF3 (NM_001659) Human Recombinant Protein
CAT#: TP306192
Recombinant protein of human ADP-ribosylation factor 3 (ARF3), 20 µg
View other "ARF3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206192 protein sequence
Red=Cloning site Green=Tags(s) MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001650 |
| Locus ID | 377 |
| UniProt ID | P61204 |
| Refseq Size | 3556 |
| Cytogenetics | 12q13.12 |
| Refseq ORF | 543 |
| Summary | ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400626 | ARF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400626 | Transient overexpression lysate of ADP-ribosylation factor 3 (ARF3) |
CNY 3080.00 |
|
| PH306192 | ARF3 MS Standard C13 and N15-labeled recombinant protein (NP_001650) |
CNY 19520.00 |
