Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein
CAT#: TP306285
Recombinant protein of human centrin, EF-hand protein, 1 (CETN1), 20 µg
View other "Centrin 1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206285 protein sequence
Red=Cloning site Green=Tags(s) MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMK KMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDE ELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004057 |
| Locus ID | 1068 |
| UniProt ID | Q12798 |
| Refseq Size | 1161 |
| Cytogenetics | 18p11.32 |
| Refseq ORF | 516 |
| Synonyms | CEN1; CETN |
| Summary | The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jan 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401316 | CETN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401316 | Transient overexpression lysate of centrin, EF-hand protein, 1 (CETN1) |
CNY 3080.00 |
|
| PH306285 | CETN1 MS Standard C13 and N15-labeled recombinant protein (NP_004057) |
CNY 19520.00 |
其它Centrin 1产品
