NCALD (NM_001040630) Human Recombinant Protein
CAT#: TP306321
Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 7, 20 µg
View other "NCALD" proteins (32)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206321 protein sequence
Red=Cloning site Green=Tags(s) MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE DESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035720 |
| Locus ID | 83988 |
| UniProt ID | P61601 |
| Refseq Size | 3826 |
| Cytogenetics | 8q22.3 |
| Refseq ORF | 579 |
| Summary | This gene encodes a member of the neuronal calcium sensor (NCS) family of calcium-binding proteins. The protein contains an N-terminal myristoylation signal and four EF-hand calcium binding loops. The protein is cytosolic at resting calcium levels; however, elevated intracellular calcium levels induce a conformational change that exposes the myristoyl group, resulting in protein association with membranes and partial co-localization with the perinuclear trans-golgi network. The protein is thought to be a regulator of G protein-coupled receptor signal transduction. Several alternatively spliced variants of this gene have been determined, all of which encode the same protein; additional variants may exist but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410350 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421783 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421784 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421785 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421786 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421787 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421788 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421789 | NCALD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410350 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 8 |
CNY 3080.00 |
|
| LY421783 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 1 |
CNY 3080.00 |
|
| LY421784 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 2 |
CNY 3080.00 |
|
| LY421785 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 3 |
CNY 3080.00 |
|
| LY421786 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 4 |
CNY 3080.00 |
|
| LY421787 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 5 |
CNY 3080.00 |
|
| LY421788 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 6 |
CNY 3080.00 |
|
| LY421789 | Transient overexpression lysate of neurocalcin delta (NCALD), transcript variant 7 |
CNY 3080.00 |
|
| PH306321 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035720) |
CNY 14250.00 |
|
| PH312908 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035718) |
CNY 14250.00 |
|
| PH313925 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035715) |
CNY 14250.00 |
|
| PH314160 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035716) |
CNY 14250.00 |
|
| PH314659 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_114430) |
CNY 19520.00 |
|
| PH318434 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035719) |
CNY 14250.00 |
|
| PH320693 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035717) |
CNY 14250.00 |
|
| PH321428 | NCALD MS Standard C13 and N15-labeled recombinant protein (NP_001035714) |
CNY 14250.00 |
|
| TP312908 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP313925 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP314160 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP314659 | Recombinant protein of human neurocalcin delta (NCALD), transcript variant 8, 20 µg |
CNY 2900.00 |
|
| TP318434 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 6, 20 µg |
CNY 2900.00 |
|
| TP320693 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP321428 | Purified recombinant protein of Homo sapiens neurocalcin delta (NCALD), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720212 | Recombinant protein of human neurocalcin delta (NCALD), transcript variant 1 |
CNY 1800.00 |
