CPNE7 (NM_153636) Human Recombinant Protein
CAT#: TP306428
Recombinant protein of human copine VII (CPNE7), transcript variant 1, 20 µg
View other "CPNE7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 7 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206428 protein sequence
Red=Cloning site Green=Tags(s) MSAGSERGAAATPGGLPAPCASKVELRLSCRHLLDRDPLTKSDPSVALLQQAQGQWVQVGRTEVVRSSLH PVFSKVFTVDYYFEEVQRLRFEVYDTHGPSGFSCQEDDFLGGMECTLGQIVAQKKVTRPLLLKFGRNAGK STITVIAEDISGNNGYVELSFRARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNPVWEAF KVSLSSLCSCEETRPLKCLVWDYDSRGKHDFIGEFSTTFEEMQKAFEEGQAQWDCVNPKYKQKRRSYKNS GVVVLADLKFHRVYSFLDYIMGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLKALVSVGEICQ DYDSDKRFSALGFGARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPRVQLYGPTNVAPIISKV ARVAAAEESTGKASQYYILLILTDGVVTDMADTREAIVRASRLPMSIIIVGVGNADFTDMQVLDGDDGVL RSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEASPGCTP SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 61.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | In vivo treatment (PMID: 29525888) |
| Reference Data | |
| RefSeq | NP_705900 |
| Locus ID | 27132 |
| UniProt ID | Q9UBL6 |
| Refseq Size | 2449 |
| Cytogenetics | 16q24.3 |
| Refseq ORF | 1674 |
| Summary | This gene encodes a member of the copine family, which is composed of calcium-dependent membrane-binding proteins. The gene product contains two N-terminal C2 domains and one von Willebrand factor A domain. The encoded protein may be involved in membrane trafficking. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008] |
Citations (7)
| The use of this Proteins has been cited in the following citations: |
|---|
|
CPNE7-Induced Autophagy Restores the Physiological Function of Mature Odontoblasts
,null,
Frontiers in Cell and Developmental Biology
,PubMed ID 33981704
[CPNE7]
|
|
CPNE7 Induces Biological Dentin Sealing in a Dentin Hypersensitivity Model
,Park, SH;Lee, YS;Lee, DS;Park, JC;Kim, R;Shon, WJ;,
J. Dent. Res.
,PubMed ID 31425664
[CPNE7]
|
|
The effect of CPNE7 on periodontal regeneration
,Choung, HW;Lee, DS;Park, YH;Lee, YS;Bai, S;Yoo, SH;Lee, JH;You, HK;Park, JC;,
Connect. Tissue Res.
,PubMed ID 30734591
[CPNE7]
|
|
Effect of preameloblast-conditioned medium and CPNE7 on root surfaces in dogs: a histologic and histomorphometric evaluation
,Yu, SJ;Lee, YS;Choung, HW;Park, YH;Kim, BO;Park, JC;,
J. Mol. Histol.
,PubMed ID 29525888
[CPNE7]
|
|
Copine-7 binds to the cell surface receptor, nucleolin, and regulates ciliogenesis and Dspp expression during odontoblast differentiation
,null,
Scientific Reports
,PubMed ID 28900213
[CPNE7]
|
|
CPNE7, a preameloblast-derived factor, regulates odontoblastic differentiation of mesenchymal stem cells.
,null,
Biomaterials
,PubMed ID 25453951
[CPNE7]
|
|
CPNE7, a preameloblast-derived factor, regulates odontoblastic differentiation of mesenchymal stem cells
,Oh, HJ;Choung, HW;Lee, HK;Park, SJ;Lee, JH;Lee, DS;,
Biomaterials
[CPNE7]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406997 | CPNE7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406997 | Transient overexpression lysate of copine VII (CPNE7), transcript variant 1 |
CNY 3080.00 |
|
| PH306428 | CPNE7 MS Standard C13 and N15-labeled recombinant protein (NP_705900) |
CNY 19520.00 |
