Myozenin 1 (MYOZ1) (NM_021245) Human Recombinant Protein
CAT#: TP306448
Recombinant protein of human myozenin 1 (MYOZ1), 20 µg
View other "Myozenin 1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206448 protein sequence
Red=Cloning site Green=Tags(s) MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKF IYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSG AGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYG AKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGE PVDYNVDIGIPLDGETEEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_067068 |
| Locus ID | 58529 |
| UniProt ID | Q9NP98 |
| Refseq Size | 1583 |
| Cytogenetics | 10q22.2 |
| Refseq ORF | 897 |
| Synonyms | CS-2; FATZ; MYOZ |
| Summary | The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411997 | MYOZ1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411997 | Transient overexpression lysate of myozenin 1 (MYOZ1) |
CNY 3080.00 |
|
| PH306448 | MYOZ1 MS Standard C13 and N15-labeled recombinant protein (NP_067068) |
CNY 19520.00 |
|
| TP761507 | Purified recombinant protein of Human myozenin 1 (MYOZ1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Myozenin 1产品
