KCNE1L (KCNE5) (NM_012282) Human Recombinant Protein
CAT#: TP306502
Recombinant protein of human KCNE1-like (KCNE1L), 20 µg
View other "KCNE1L" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206502 protein sequence
Red=Cloning site Green=Tags(s) MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFY ACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAE RV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036414 |
Locus ID | 23630 |
UniProt ID | Q9UJ90 |
Refseq Size | 1465 |
Cytogenetics | Xq23 |
Refseq ORF | 426 |
Synonyms | KCNE1L |
Summary | This gene encodes a member of a family of single pass transmembrane domain proteins that function as ancillary subunits to voltage-gated potassium channels. Members of this family affect diverse processes in potassium channel regulation, including ion selectivity, voltage dependence, and anterograde recycling from the plasma membrane. Variants of this gene are associated with idiopathic ventricular fibrillation and Brugada syndrome. [provided by RefSeq, Nov 2016] |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The IKs Channel Response to cAMP Is Modulated by the KCNE1:KCNQ1 Stoichiometry
,Thompson, E;Eldstrom, J;Westhoff, M;McAfee, D;Fedida, D;,
Biophys. J.
,PubMed ID 30314657
[KCNE5]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |