RAB27B (NM_004163) Human Recombinant Protein
CAT#: TP306519
Recombinant protein of human RAB27B, member RAS oncogene family (RAB27B), 20 µg
View other "RAB27B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206519 protein sequence
Red=Cloning site Green=Tags(s) MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHL QLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQ REVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEK PPEKKCIC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004154 |
Locus ID | 5874 |
UniProt ID | O00194 |
Refseq Size | 7003 |
Cytogenetics | 18q21.2 |
Refseq ORF | 654 |
Synonyms | C25KG |
Summary | Members of the Rab protein family, including RAB27B, are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking (Chen et al., 1997 [PubMed 9066979]).[supplied by OMIM, Nov 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418170 | RAB27B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418170 | Transient overexpression lysate of RAB27B, member RAS oncogene family (RAB27B) |
CNY 3080.00 |
|
PH306519 | RAB27B MS Standard C13 and N15-labeled recombinant protein (NP_004154) |
CNY 19520.00 |