GBP5 (NM_052942) Human Recombinant Protein
CAT#: TP306627
Recombinant protein of human guanylate binding protein 5 (GBP5), transcript variant 1, 20 µg
View other "GBP5" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206627 protein sequence
Red=Cloning site Green=Tags(s) MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSVAST VQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALALLLSSTFVYNTVNKIDQGAID LLHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTLRDFCLGLEIDGQLVTPDEYLENSLRPKQGS DQRVQNFNLPRLCIQKFFPKKKCFIFDLPAHQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTL PGGIMVNGSRLKNLVLTYVNAISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQE LLDLHRTSEREAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAV KQGIYSKPGGHNLFIQKTEELKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQALTETEKKKKEA QVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQ AQNRSLLSELQHAQRTVNNDDPCVLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 66.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443174 |
Locus ID | 115362 |
UniProt ID | Q96PP8 |
Refseq Size | 4065 |
Cytogenetics | 1p22.2 |
Refseq ORF | 1758 |
Synonyms | GBP-5 |
Summary | This gene belongs to the TRAFAC class dynamin-like GTPase superfamily. The encoded protein acts as an activator of NLRP3 inflammasome assembly and has a role in innate immunity and inflammation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409377 | GBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427458 | GBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409377 | Transient overexpression lysate of guanylate binding protein 5 (GBP5), transcript variant 1 |
CNY 3080.00 |
|
LY427458 | Transient overexpression lysate of guanylate binding protein 5 (GBP5), transcript variant 2 |
CNY 3080.00 |
|
PH306627 | GBP5 MS Standard C13 and N15-labeled recombinant protein (NP_443174) |
CNY 19520.00 |
|
PH325986 | GBP5 MS Standard C13 and N15-labeled recombinant protein (NP_001127958) |
CNY 19520.00 |
|
TP325986 | Recombinant protein of human guanylate binding protein 5 (GBP5), transcript variant 2, 20 µg |
CNY 2900.00 |