RNF36 (TRIM69) (NM_080745) Human Recombinant Protein
CAT#: TP306702
Recombinant protein of human tripartite motif-containing 69 (TRIM69), transcript variant b, 20 µg
View other "RNF36" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206702 protein sequence
Red=Cloning site Green=Tags(s) MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEG KALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNL GQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGDIKKIMPDDPERFDSSVAVLG SRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRNQTDLKALDLPSFSLTLTNN LDKVGIYLDYEGGQLSFYNAKTMTHIYTFSNTFMEKLYPYFCPCLNDGGENKEPLHILHPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_542783 |
| Locus ID | 140691 |
| UniProt ID | Q86WT6 |
| Refseq Size | 1437 |
| Cytogenetics | 15q21.1 |
| Refseq ORF | 1023 |
| Synonyms | HSD-34; HSD34; RNF36; Trif |
| Summary | This gene encodes a member of the RING-B-box-coiled-coil (RBCC) family and encodes a protein with an N-terminal RING finger motif, a PRY domain and a C-terminal SPRY domain. The mouse ortholog of this gene is specifically expressed in germ cells at the round spermatid stages during spermatogenesis and, when overexpressed, induces apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405299 | TRIM69 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409062 | TRIM69 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405299 | Transient overexpression lysate of tripartite motif-containing 69 (TRIM69), transcript variant a |
CNY 3080.00 |
|
| LY409062 | Transient overexpression lysate of tripartite motif-containing 69 (TRIM69), transcript variant b |
CNY 3080.00 |
|
| PH306702 | TRIM69 MS Standard C13 and N15-labeled recombinant protein (NP_542783) |
CNY 19520.00 |
