IGSF11 (NM_152538) Human Recombinant Protein
CAT#: TP306735
Recombinant protein of human immunoglobulin superfamily, member 11 (IGSF11), transcript variant 1, 20 µg
View other "IGSF11" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206735 protein sequence
Red=Cloning site Green=Tags(s) MSLVELLLWWNCFSRTGVAASLEVSESPGSIQVARGQTAVLPCTFTTSAALINLNVIWMVTPLSNANQPE QVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVL VPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSG LYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEIP NEIREDDLPPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGN ANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVMV PAQSRAGSLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689751 |
| Locus ID | 152404 |
| UniProt ID | Q5DX21 |
| Refseq Size | 3577 |
| Cytogenetics | 3q13.32 |
| Refseq ORF | 1290 |
| Synonyms | BT-IgSF; CT119; CXADRL1; Igsf13; VSIG3 |
| Summary | IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).[supplied by OMIM, Apr 2005] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407451 | IGSF11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407451 | Transient overexpression lysate of immunoglobulin superfamily, member 11 (IGSF11), transcript variant 1 |
CNY 3080.00 |
|
| PH306735 | IGSF11 MS Standard C13 and N15-labeled recombinant protein (NP_689751) |
CNY 19520.00 |
