CYTL1 (NM_018659) Human Recombinant Protein
CAT#: TP306778M
Recombinant protein of human cytokine-like 1 (CYTL1), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206778 protein sequence
Red=Cloning site Green=Tags(s) MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Cell treatment (PMID: 28244648) |
| Reference Data | |
| RefSeq | NP_061129 |
| Locus ID | 54360 |
| UniProt ID | Q9NRR1 |
| Refseq Size | 1019 |
| Cytogenetics | 4p16.2 |
| Refseq ORF | 408 |
| Synonyms | C4orf4; C17 |
| Summary | C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
