Ramp4 2 (SERP2) (NM_001010897) Human Recombinant Protein
CAT#: TP306796
Recombinant protein of human stress-associated endoplasmic reticulum protein family member 2 (SERP2), 20 µg
View other "Ramp4 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206796 protein sequence
Red=Cloning site Green=Tags(s) MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001010897 |
Locus ID | 387923 |
UniProt ID | Q8N6R1 |
Refseq Size | 842 |
Cytogenetics | 13q14.11 |
Refseq ORF | 195 |
Synonyms | bA269C23.1; C13orf21 |
Summary | May interact with target proteins during translocation into the lumen of the endoplasmic reticulum. May protect unfolded target proteins against degradation and facilitate correct glycosylation (Potential).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423217 | SERP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423217 | Transient overexpression lysate of stress-associated endoplasmic reticulum protein family member 2 (SERP2) |
CNY 3080.00 |
|
PH306796 | SERP2 MS Standard C13 and N15-labeled recombinant protein (NP_001010897) |
CNY 19520.00 |
其它Ramp4 2产品