ATP6V1H (NM_015941) Human Recombinant Protein
CAT#: TP306841L
Recombinant protein of human ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 1, 1 mg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 36000.00
CNY 6281.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC206841 protein sequence 
Red=Cloning site Green=Tags(s) MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEG SQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNRQDPFTVHM AARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLR VNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEK VTRIILAAFRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLS SFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 55.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_057025 | 
| Locus ID | 51606 | 
| UniProt ID | Q9UI12 | 
| Refseq Size | 2186 | 
| Cytogenetics | 8q11.23 | 
| Refseq ORF | 1449 | 
| Synonyms | CGI-11; MSTP042; NBP1; SFD; SFDalpha; SFDbeta; VMA13 | 
| Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular organelles. V-ATPase-dependent organelle acidification is necessary for multiple processes including protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. The encoded protein is the regulatory H subunit of the V1 domain of V-ATPase, which is required for catalysis of ATP but not the assembly of V-ATPase. Decreased expression of this gene may play a role in the development of type 2 diabetes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] | 
| Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection | 
Documents
| FAQs | 
| SDS | 
其它ATP6V1H产品
