United States
Germany
Japan
United Kingdom
China
GRB10 (NM_001001555) Human Recombinant Protein
CAT＃: TP306853
Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 4, 20 µg
View other "GRB10" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206853 protein sequence
Red=Cloning site Green=Tags(s) MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQ QFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLV YKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVT WCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLAD LEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYR IPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPL HPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCE DDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 60.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001001555 |
| Locus ID | 2887 |
| UniProt ID | Q13322 |
| Refseq Size | 5040 |
| Cytogenetics | 7p12.1 |
| Refseq ORF | 1608 |
| Synonyms | Grb-10; GRB-IR; IRBP; MEG1; RSS |
| Summary | The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2010] |
| Protein Families | Druggable Genome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Antigen-specificity of antiretinal antibodies in patients with noninfectious uveitis
,Gibbs, E;Matsubara, J;Cao, S;Cui, J;Forooghian, F;,
Canadian Journal of Ophthalmology / Journal Canadien d'Ophtalmologie
[GRB10]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417385 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424374 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424375 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424378 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417385 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 1 |
CNY 4,840.00 |
|
| LY424374 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 2 |
CNY 4,840.00 |
|
| LY424375 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 3 |
CNY 4,840.00 |
|
| LY424378 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 4 |
CNY 3,080.00 |
|
| PH306853 | GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001555) |
CNY 19,520.00 |
|
| PH320822 | GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001550) |
CNY 19,520.00 |
|
| TP320822 | Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 3, 20 µg |
CNY 2,900.00 |
