DUSP28 (NM_001033575) Human Recombinant Protein
CAT#: TP306912
Recombinant protein of human dual specificity phosphatase 28 (DUSP28), 20 µg
View other "DUSP28" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206912 protein sequence
Red=Cloning site Green=Tags(s) MGPAEAGRRGAASPVPPPLVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPV FDDPAEDLLAHLEPTCAAMEAAVRAGGACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVA EPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028747 |
Locus ID | 285193 |
UniProt ID | Q4G0W2 |
Refseq Size | 1555 |
Cytogenetics | 2q37.3 |
Refseq ORF | 528 |
Synonyms | DUSP26; VHP |
Summary | Has phosphatase activity with the synthetic substrate 6,8-difluoro-4-methylumbelliferyl phosphate (in vitro) (PubMed:24531476, PubMed:29121083). Has almost no detectable activity with phosphotyrosine, even less activity with phosphothreonine and displays complete lack of activity with phosphoserine (PubMed:29121083). The poor activity with phosphotyrosine may be due to steric hindrance by bulky amino acid sidechains that obstruct access to the active site (PubMed:29121083).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422400 | DUSP28 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422400 | Transient overexpression lysate of dual specificity phosphatase 28 (DUSP28) |
CNY 3080.00 |
|
PH306912 | DUSP28 MS Standard C13 and N15-labeled recombinant protein (NP_001028747) |
CNY 14250.00 |