C7orf16 (PPP1R17) (NM_006658) Human Recombinant Protein
CAT#: TP307007
Recombinant protein of human chromosome 7 open reading frame 16 (C7orf16), transcript variant 1, 20 µg
View other "C7orf16" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 2700.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207007 protein sequence
Red=Cloning site Green=Tags(s) MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPA LHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPK AIVEDDEKDGDKIAI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006649 |
| Locus ID | 10842 |
| UniProt ID | O96001 |
| Refseq Size | 1966 |
| Cytogenetics | 7p14.3 |
| Refseq ORF | 465 |
| Synonyms | C7orf16; GSBS |
| Summary | The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010] |
| Protein Pathways | Long-term depression |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416501 | PPP1R17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416501 | Transient overexpression lysate of chromosome 7 open reading frame 16 (C7orf16), transcript variant 1 |
CNY 3080.00 |
|
| PH307007 | C7orf16 MS Standard C13 and N15-labeled recombinant protein (NP_006649) |
CNY 19520.00 |
其它C7orf16产品
