METTL27 (NM_152559) Human Recombinant Protein
CAT#: TP307050
Recombinant protein of human Williams Beuren syndrome chromosome region 27 (WBSCR27), 20 µg
View other "METTL27" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207050 protein sequence
Red=Cloning site Green=Tags(s) MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSAL ILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGA LSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSW LPPSWWWYPASLPRMASSPALSTCTESGRRPRLRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689772 |
Locus ID | 155368 |
UniProt ID | Q8N6F8 |
Refseq Size | 958 |
Cytogenetics | 7q11.23 |
Refseq ORF | 735 |
Synonyms | WBSCR27 |
Summary | This gene encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407469 | WBSCR27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407469 | Transient overexpression lysate of Williams Beuren syndrome chromosome region 27 (WBSCR27) |
CNY 3080.00 |
|
PH307050 | WBSCR27 MS Standard C13 and N15-labeled recombinant protein (NP_689772) |
CNY 19520.00 |
其它METTL27产品