BATF (NM_006399) Human Recombinant Protein
CAT#: TP307104
Recombinant protein of human basic leucine zipper transcription factor, ATF-like (BATF), 20 µg
View other "BATF" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207104 protein sequence
Red=Cloning site Green=Tags(s) MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRK EIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006390 |
Locus ID | 10538 |
UniProt ID | Q16520 |
Refseq Size | 953 |
Cytogenetics | 14q24.3 |
Refseq ORF | 375 |
Synonyms | B-ATF; BATF1; SFA-2; SFA2 |
Summary | The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416664 | BATF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416664 | Transient overexpression lysate of basic leucine zipper transcription factor, ATF-like (BATF) |
CNY 3080.00 |
|
PH307104 | BATF MS Standard C13 and N15-labeled recombinant protein (NP_006390) |
CNY 19520.00 |