CSRP1 (NM_004078) Human Recombinant Protein
CAT#: TP307109
Recombinant protein of human cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1, 20 µg
View other "CSRP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207109 protein sequence
Red=Cloning site Green=Tags(s) MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004069 |
| Locus ID | 1465 |
| UniProt ID | P21291 |
| Refseq Size | 1970 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 579 |
| Synonyms | CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286 |
| Summary | This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Cross-reactivity of a pathogenic autoantibody to a tumor antigen in GABAA receptor encephalitis
,Brändle, SM;Cerina, M;Weber, S;Held, K;Menke, AF;Alcalá, C;Gebert, D;Herrmann, AM;Pellkofer, H;Gerdes, LA;Bittner, S;Leypoldt, F;Teegen, B;Komorowski, L;Kümpfel, T;Hohlfeld, R;Meuth, SG;Casanova, B;Melzer, N;Beltrán, E;Dornmair, K;,
Proceedings of the National Academy of Sciences of the United States of America
,PubMed ID 33619082
[CSRP1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418221 | CSRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418221 | Transient overexpression lysate of cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1 |
CNY 3080.00 |
|
| PH307109 | CSRP1 MS Standard C13 and N15-labeled recombinant protein (NP_004069) |
CNY 19520.00 |
