IMPDH1 (NM_183243) Human Recombinant Protein
CAT＃: TP307118
Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2, 20 µg
View other "IMPDH1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207118 protein sequence
Red=Cloning site Green=Tags(s) MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESMADYLISGGTGYVPEDGLTAQ QLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFI HHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSR DIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNR DYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIG GNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVG HVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQ GVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEK RLY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_899066 |
| Locus ID | 3614 |
| UniProt ID | P20839 |
| Refseq Size | 2517 |
| Cytogenetics | 7q32.1 |
| Refseq ORF | 1689 |
| Synonyms | IMPD; IMPD1; IMPDH-I; LCA11; RP10; sWSS2608 |
| Summary | The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400315 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405238 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420173 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428185 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428186 | IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400315 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1 |
CNY 4840.00 |
|
| LY405238 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2 |
CNY 3080.00 |
|
| LY420173 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 3 |
CNY 4840.00 |
|
| LY428185 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 7 |
CNY 3080.00 |
|
| LY428186 | Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 4 |
CNY 3080.00 |
|
| PH307118 | IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_899066) |
CNY 19520.00 |
|
| PH315206 | IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_000874) |
CNY 19520.00 |
|
| TP315206 | Recombinant protein of human IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1, 20 µg |
CNY 2900.00 |
