KCNRG (NM_173605) Human Recombinant Protein
CAT#: TP307143
Recombinant protein of human potassium channel regulator (KCNRG), transcript variant 1, 20 µg
View other "KCNRG" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207143 protein sequence
Red=Cloning site Green=Tags(s) MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQL LLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRI TVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRYVSIKPDNRKLANGTNV LGLLIDTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPEQSQIKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_775876 |
| Locus ID | 283518 |
| UniProt ID | Q8N5I3 |
| Refseq Size | 1527 |
| Cytogenetics | 13q14.2 |
| Refseq ORF | 816 |
| Synonyms | DLTET |
| Summary | This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403557 | KCNRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404578 | KCNRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403557 | Transient overexpression lysate of potassium channel regulator (KCNRG), transcript variant 1 |
CNY 3080.00 |
|
| LY404578 | Transient overexpression lysate of potassium channel regulator (KCNRG), transcript variant 2 |
CNY 3080.00 |
|
| PH307143 | KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_775876) |
CNY 19520.00 |
|
| PH312086 | KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_955751) |
CNY 19520.00 |
|
| TP312086 | Recombinant protein of human potassium channel regulator (KCNRG), transcript variant 2, 20 µg |
CNY 2900.00 |
