C17ORF39 (GID4) (NM_024052) Human Recombinant Protein
CAT#: TP307341
Recombinant protein of human chromosome 17 open reading frame 39 (C17orf39), 20 µg
View other "C17ORF39" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207341 protein sequence
Red=Cloning site Green=Tags(s) MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVP LPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYD VEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQ YAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEW YQSLNLTHVPEHSAPIYEFR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076957 |
Locus ID | 79018 |
UniProt ID | Q8IVV7 |
Refseq Size | 4232 |
Cytogenetics | 17p11.2 |
Refseq ORF | 900 |
Synonyms | C17orf39; VID2; VID24 |
Summary | The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402976 | GID4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402976 | Transient overexpression lysate of chromosome 17 open reading frame 39 (C17orf39) |
CNY 3080.00 |
|
PH307341 | C17orf39 MS Standard C13 and N15-labeled recombinant protein (NP_076957) |
CNY 19520.00 |
其它C17ORF39产品