EXTL2 (NM_001439) Human Recombinant Protein
CAT#: TP307406
Recombinant protein of human exostoses (multiple)-like 2 (EXTL2), transcript variant 1, 20 µg
View other "EXTL2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207406 protein sequence
Red=Cloning site Green=Tags(s) MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIM QTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPE LETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSM VLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGY SGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001430 |
| Locus ID | 2135 |
| UniProt ID | Q9UBQ6 |
| Refseq Size | 3217 |
| Cytogenetics | 1p21.2 |
| Refseq ORF | 990 |
| Synonyms | EXTR2 |
| Summary | Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
| Protein Pathways | Heparan sulfate biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419935 | EXTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422342 | EXTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419935 | Transient overexpression lysate of exostoses (multiple)-like 2 (EXTL2), transcript variant 1 |
CNY 3080.00 |
|
| LY422342 | Transient overexpression lysate of exostoses (multiple)-like 2 (EXTL2), transcript variant 2 |
CNY 3080.00 |
|
| PH307406 | EXTL2 MS Standard C13 and N15-labeled recombinant protein (NP_001430) |
CNY 19520.00 |
