Cytochrome p450 2J2 (CYP2J2) (NM_000775) Human Recombinant Protein
CAT#: TP307417
Recombinant protein of human cytochrome P450, family 2, subfamily J, polypeptide 2 (CYP2J2), 20 µg
View other "Cytochrome p450 2J2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207417 protein sequence
Red=Cloning site Green=Tags(s) MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQL FVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRF TLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQ LLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDA YLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQ PSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITIS PVSHRLCAVPQV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000766 |
| Locus ID | 1573 |
| UniProt ID | P51589 |
| Refseq Size | 1876 |
| Cytogenetics | 1p32.1 |
| Refseq ORF | 1506 |
| Synonyms | CPJ2; CYPIIJ2 |
| Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome, P450, Transmembrane |
| Protein Pathways | Arachidonic acid metabolism, Linoleic acid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424525 | CYP2J2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424525 | Transient overexpression lysate of cytochrome P450, family 2, subfamily J, polypeptide 2 (CYP2J2) |
CNY 3080.00 |
|
| PH307417 | CYP2J2 MS Standard C13 and N15-labeled recombinant protein (NP_000766) |
CNY 19520.00 |
其它Cytochrome p450 2J2产品
