TEKT2 (NM_014466) Human Recombinant Protein
CAT#: TP307425
Recombinant protein of human tektin 2 (testicular) (TEKT2), 20 µg
View other "TEKT2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207425 protein sequence
Red=Cloning site Green=Tags(s) MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDT VNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKE VEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPD GSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELK WQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIA ALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKLTVPAERFVPEVDTFTRTTNSTLS PLKSCQLELA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055281 |
| Locus ID | 27285 |
| UniProt ID | Q9UIF3 |
| Refseq Size | 1536 |
| Cytogenetics | 1p34.3 |
| Refseq ORF | 1290 |
| Synonyms | h-tektin-t; TEKTB1; TEKTIN-T |
| Summary | This gene product belongs to the tektin family of proteins. Tektins comprise a family of filament-forming proteins that are coassembled with tubulins to form ciliary and flagellar microtubules. This gene is expressed in the testis and its protein is localized to the flagella of the sperms, indicating that it may play a role in spermatogenesis. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415231 | TEKT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415231 | Transient overexpression lysate of tektin 2 (testicular) (TEKT2) |
CNY 3080.00 |
|
| PH307425 | TEKT2 MS Standard C13 and N15-labeled recombinant protein (NP_055281) |
CNY 19520.00 |
