TAF7 (NM_005642) Human Recombinant Protein
CAT#: TP307437
Recombinant protein of human TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa (TAF7), 20 µg
View other "TAF7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207437 protein sequence
Red=Cloning site Green=Tags(s) MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDL PCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPL KNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQG HDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMG IQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005633 |
Locus ID | 6879 |
UniProt ID | Q15545 |
Refseq Size | 2310 |
Cytogenetics | 5q31.3 |
Refseq ORF | 1047 |
Synonyms | TAF2F; TAFII55 |
Summary | The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417173 | TAF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417173 | Transient overexpression lysate of TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa (TAF7) |
CNY 3080.00 |
|
PH307437 | TAF7 MS Standard C13 and N15-labeled recombinant protein (NP_005633) |
CNY 19520.00 |