RUFY1 (NM_001040451) Human Recombinant Protein
CAT#: TP307465
Recombinant protein of human RUN and FYVE domain containing 1 (RUFY1), transcript variant 2, 20 µg
View other "RUFY1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207465 protein sequence
Red=Cloning site Green=Tags(s) MMEERANLMHMMKLSIKVLLQSALSLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLE LVEKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMMEEE GMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYLKDVQDLDGGKEHERITDVLDQKNYVEELNRHL SCTVGDLQTKIDGLEKTNSKLQEELSAATDRICSLQEEQQQLREQNELIRERSEKSVEITKQDTKVELET YKQTRQGLDEMYSDVWKQLKEEKKVRLELEKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEE VKAINLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGG RIGALQLQLSQLHEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAE LQKICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCG HIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 68.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035541 |
| Locus ID | 80230 |
| UniProt ID | Q96T51 |
| Refseq Size | 2674 |
| Cytogenetics | 5q35.3 |
| Refseq ORF | 1800 |
| Synonyms | RABIP4; ZFYVE12 |
| Summary | This gene encodes a protein that contains a RUN domain and a FYVE-type zinc finger domain. The encoded protein binds to phosphatidylinositol-3-phosphate (PI3P) and plays a role in early endosomal trafficking, tethering and fusion through interactions with small GTPases including Rab4, Rab5 and Rab14. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410873 | RUFY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421767 | RUFY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410873 | Transient overexpression lysate of RUN and FYVE domain containing 1 (RUFY1), transcript variant 1 |
CNY 4840.00 |
|
| LY421767 | Transient overexpression lysate of RUN and FYVE domain containing 1 (RUFY1), transcript variant 2 |
CNY 3080.00 |
|
| PH307465 | RUFY1 MS Standard C13 and N15-labeled recombinant protein (NP_001035541) |
CNY 19520.00 |
|
| PH317181 | RUFY1 MS Standard C13 and N15-labeled recombinant protein (NP_079434) |
CNY 14250.00 |
|
| TP317181 | Recombinant protein of human RUN and FYVE domain containing 1 (RUFY1), transcript variant 1, 20 µg |
CNY 2900.00 |
