GOLPH3 (NM_022130) Human Recombinant Protein
CAT#: TP307477
Recombinant protein of human golgi phosphoprotein 3 (coat-protein) (GOLPH3), 20 µg
View other "GOLPH3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207477 protein sequence
Red=Cloning site Green=Tags(s) MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLG LKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHV KETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIK QRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVEC LKANTNEVLWAVVAAFTK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_071413 |
| Locus ID | 64083 |
| UniProt ID | Q9H4A6 |
| Refseq Size | 2676 |
| Cytogenetics | 5p13.3 |
| Refseq ORF | 894 |
| Synonyms | GOPP1; GPP34; MIDAS; Vps74 |
| Summary | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411758 | GOLPH3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411758 | Transient overexpression lysate of golgi phosphoprotein 3 (coat-protein) (GOLPH3) |
CNY 3080.00 |
|
| PH307477 | GOLPH3 MS Standard C13 and N15-labeled recombinant protein (NP_071413) |
CNY 14250.00 |

