EVI2A (NM_014210) Human Recombinant Protein
CAT#: TP307538
Recombinant protein of human ecotropic viral integration site 2A (EVI2A), transcript variant 2, 20 µg
View other "EVI2A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207538 protein sequence
Red=Cloning site Green=Tags(s) MPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDY KGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLI IIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQ STGVLTATRERKDEEGTEKLTNKQIG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055025 |
Locus ID | 2123 |
UniProt ID | P22794 |
Refseq Size | 2869 |
Cytogenetics | 17q11.2 |
Refseq ORF | 708 |
Synonyms | EVDA; EVI-2A; EVI2 |
Summary | May complex with itself or/and other proteins within the membrane, to function as part of a cell-surface receptor.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415446 | EVI2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415446 | Transient overexpression lysate of ecotropic viral integration site 2A (EVI2A), transcript variant 2 |
CNY 3080.00 |
|
PH307538 | EVI2A MS Standard C13 and N15-labeled recombinant protein (NP_055025) |
CNY 19520.00 |