RACGAP1 (NM_013277) Human Recombinant Protein
CAT#: TP307542
Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 1, 20 µg
View other "RACGAP1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207542 protein sequence
Red=Cloning site Green=Tags(s) MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDV KLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGN KRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQ GNESIVAKTTVTVPNDGGPIEAVSTIETVPYWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQS NGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLIGTPVKIGEGM LADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDIHAICS LLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHLQRVAQSPHTK MDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPM LK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 70.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_037409 |
| Locus ID | 29127 |
| UniProt ID | Q9H0H5 |
| Refseq Size | 3315 |
| Cytogenetics | 12q13.12 |
| Refseq ORF | 1896 |
| Synonyms | CYK4; HsCYK-4; ID-GAP; MgcRacGAP |
| Summary | This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402238 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426645 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426646 | RACGAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402238 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 1 |
CNY 3080.00 |
|
| LY426645 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 2 |
CNY 3080.00 |
|
| LY426646 | Transient overexpression lysate of Rac GTPase activating protein 1 (RACGAP1), transcript variant 3 |
CNY 3080.00 |
|
| PH307542 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_037409) |
CNY 19520.00 |
|
| PH326045 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119575) |
CNY 14250.00 |
|
| PH326046 | RACGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001119576) |
CNY 19520.00 |
|
| TP326045 | Purified recombinant protein of Homo sapiens Rac GTPase activating protein 1 (RACGAP1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326046 | Recombinant protein of human Rac GTPase activating protein 1 (RACGAP1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它RACGAP1产品
