ZFP200 (ZNF200) (NM_003454) Human Recombinant Protein
CAT#: TP307594
Recombinant protein of human zinc finger protein 200 (ZNF200), transcript variant 1, 20 µg
View other "ZFP200" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207594 protein sequence
Red=Cloning site Green=Tags(s) MMAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLVQPSQKVKETL VIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFEDLNVFHCQEECVSLDPTQQLT SEKEDDSSVGEMMLLAVNGSNPEGEDPEREPVENEDYREKSSDDDEMDSSLVSQQPPDNQEKERLNTSIP QKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPY DCNHCGKSFNHKTNLNKHERIHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPKNEE FVLHLQSHEAERPYGCKKCGRRFGRLSNCTRHEKTHSACKTRKQK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 45.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003445 |
| Locus ID | 7752 |
| UniProt ID | P98182 |
| Refseq Size | 3387 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 1185 |
| Summary | Could have a role in spermatogenesis.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405074 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405075 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418671 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428893 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428894 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428895 | ZNF200 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405074 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 3 |
CNY 3080.00 |
|
| LY405075 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 2 |
CNY 3080.00 |
|
| LY418671 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 1 |
CNY 3080.00 |
|
| LY428893 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 4 |
CNY 3080.00 |
|
| LY428894 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 5 |
CNY 3080.00 |
|
| LY428895 | Transient overexpression lysate of zinc finger protein 200 (ZNF200), transcript variant 6 |
CNY 3080.00 |
|
| PH307594 | ZNF200 MS Standard C13 and N15-labeled recombinant protein (NP_003445) |
CNY 19520.00 |
|
| TP760180 | Recombinant protein of human zinc finger protein 200 (ZNF200), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760732 | Purified recombinant protein of Human zinc finger protein 200 (ZNF200), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
