FAM119A (METTL21A) (NM_145280) Human Recombinant Protein
CAT#: TP307629
Recombinant protein of human family with sequence similarity 119, member A (FAM119A), transcript variant 1, 20 µg
View other "FAM119A" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207629 protein sequence
Red=Cloning site Green=Tags(s) MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQ KRNQKEDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_660323 |
| Locus ID | 151194 |
| UniProt ID | Q8WXB1 |
| Refseq Size | 4748 |
| Cytogenetics | 2q33.3 |
| Refseq ORF | 654 |
| Synonyms | FAM119A; HCA557b; HSPA-KMT |
| Summary | Protein-lysine methyltransferase that selectively trimethylates residues in heat shock protein 70 (HSP70) family members. Contributes to the in vivo trimethylation of Lys residues in HSPA1 and HSPA8. In vitro methylates 'Lys-561' in HSPA1, 'Lys-564' in HSPA2, 'Lys-585' in HSPA5, 'Lys-563' in HSPA6 and 'Lys-561' in HSPA8.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408004 | METTL21A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426777 | METTL21A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408004 | Transient overexpression lysate of family with sequence similarity 119, member A (FAM119A), transcript variant 1 |
CNY 3080.00 |
|
| LY426777 | Transient overexpression lysate of family with sequence similarity 119, member A (FAM119A), transcript variant 2 |
CNY 3080.00 |
|
| PH307629 | FAM119A MS Standard C13 and N15-labeled recombinant protein (NP_660323) |
CNY 19520.00 |
|
| TP760710 | Purified recombinant protein of Human methyltransferase like 21A (METTL21A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它FAM119A产品
