SEPTIN12 (NM_144605) Human Recombinant Protein
CAT#: TP307655
Recombinant protein of human septin 12 (SEPT12), 20 µg
View other "SEPTIN12" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207655 protein sequence
Red=Cloning site Green=Tags(s) MDPLRRSPSPCLSSQPSSPSTPPCEMLGPVGIEAVLDQLKIKAMKMGFEFNIMVVGQSGLGKSTMVNTLF KSKVWKSNPPGLGVPTPQTLQLHSLTHVIEEKGVKLKLTVTDTPGFGDQINNDNCWDPILGYINEQYEQY LQEEILITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLQRLCRTVNVVPVIARADSLTMEEREAFRRR IQQNLRTHCIDVYPQMCFDEDINDKILNSKLRDRIPFAVVGADQEHLVNGRCVLGRKTKWGIIEVENMAH CEFPLLRDLLIRSHLQDLKDITHNIHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGA HDDSDDEF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_653206 |
| Locus ID | 124404 |
| UniProt ID | Q8IYM1 |
| Refseq Size | 1524 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 1074 |
| Synonyms | SEPT12; SPGF10 |
| Summary | This gene encodes a guanine-nucleotide binding protein and member of the septin family of cytoskeletal GTPases. Septins play important roles in cytokinesis, exocytosis, embryonic development, and membrane dynamics. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408232 | 42259 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431273 | 42259 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408232 | Transient overexpression lysate of septin 12 (SEPT12), transcript variant 2 |
CNY 3080.00 |
|
| LY431273 | Transient overexpression lysate of septin 12 (SEPT12), transcript variant 1 |
CNY 3080.00 |
|
| PH307655 | SEPT12 MS Standard C13 and N15-labeled recombinant protein (NP_653206) |
CNY 19520.00 |
其它SEPTIN12产品
