KCTD10 (NM_031954) Human Recombinant Protein
CAT#: TP307723
Recombinant protein of human potassium channel tetramerisation domain containing 10 (KCTD10), 20 µg
View other "KCTD10" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207723 protein sequence
Red=Cloning site Green=Tags(s) MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTD SEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKV PVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDE ICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAG RSHHLDEDEERERIERVRRIHIKRPDDRAHLHQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114160 |
Locus ID | 83892 |
UniProt ID | Q9H3F6 |
Refseq Size | 4057 |
Cytogenetics | 12q24.11 |
Refseq ORF | 939 |
Synonyms | BTBD28; hBACURD3; MSTP028; ULRO61 |
Summary | The protein encoded by this gene binds proliferating cell nuclear antigen (PCNA) and may be involved in DNA synthesis and cell proliferation. In addition, the encoded protein may be a tumor suppressor. Several protein-coding and non-protein coding transcript variants have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410399 | KCTD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410399 | Transient overexpression lysate of potassium channel tetramerisation domain containing 10 (KCTD10) |
CNY 3080.00 |
|
PH307723 | KCTD10 MS Standard C13 and N15-labeled recombinant protein (NP_114160) |
CNY 19520.00 |