NUDT12 (NM_031438) Human Recombinant Protein
CAT#: TP307724
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 12 (NUDT12), 20 µg
View other "NUDT12" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207724 protein sequence
Red=Cloning site Green=Tags(s) MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPEIVQFLLEKGC DRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDWLL AKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIFLGVELEIKDKLL NYAGEVPREEEDGLVAWFALGIDPIAAEEFKQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSR YKFCPTCGNATKIEEGGYKRLCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMF TCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_113626 |
| Locus ID | 83594 |
| UniProt ID | Q9BQG2 |
| Refseq Size | 3514 |
| Cytogenetics | 5q21.2 |
| Refseq ORF | 1386 |
| Summary | Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances (Abdelraheim et al., 2003 [PubMed 12790796]).[supplied by OMIM, Mar 2008] |
| Protein Pathways | Nicotinate and nicotinamide metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410513 | NUDT12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410513 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 12 (NUDT12) |
CNY 3080.00 |
|
| PH307724 | NUDT12 MS Standard C13 and N15-labeled recombinant protein (NP_113626) |
CNY 19520.00 |
