ATP5PD (NM_006356) Human Recombinant Protein
CAT#: TP307908
Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (ATP5H), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "ATP5PD" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207908 protein sequence
Red=Cloning site Green=Tags(s) MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDF EKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAF PETKLDKKKYPYWPHQPIENL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006347 |
| Locus ID | 10476 |
| UniProt ID | O75947 |
| Refseq Size | 628 |
| Cytogenetics | 17q25.1 |
| Refseq ORF | 483 |
| Synonyms | APT5H; ATP5H; ATPQ |
| Summary | Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq, Jun 2010] |
| Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416696 | ATP5H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416696 | Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (ATP5H), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| PH307908 | ATP5H MS Standard C13 and N15-labeled recombinant protein (NP_006347) |
CNY 19520.00 |
