HSPC111 (NOP16) (NM_016391) Human Recombinant Protein
CAT#: TP308009
Recombinant protein of human NOP16 nucleolar protein homolog (yeast) (NOP16), 20 µg
View other "HSPC111" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208009 protein sequence
Red=Cloning site Green=Tags(s) MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRK RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNY YQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057475 |
Locus ID | 51491 |
UniProt ID | Q9Y3C1 |
Refseq Size | 1071 |
Cytogenetics | 5q35.2 |
Refseq ORF | 534 |
Synonyms | HSPC111; HSPC185 |
Summary | This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413994 | NOP16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413994 | Transient overexpression lysate of NOP16 nucleolar protein homolog (yeast) (NOP16) |
CNY 3080.00 |
|
PH308009 | NOP16 MS Standard C13 and N15-labeled recombinant protein (NP_057475) |
CNY 19520.00 |
其它HSPC111产品