CWC15 (NM_016403) Human Recombinant Protein
CAT#: TP308046
Recombinant protein of human CWC15 spliceosome-associated protein homolog (S. cerevisiae) (CWC15), 20 µg
View other "CWC15" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208046 protein sequence
Red=Cloning site Green=Tags(s) MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAA AREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKER AEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRF VNDTLRSEFHKKFMEKYIK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057487 |
Locus ID | 51503 |
UniProt ID | Q9P013 |
Refseq Size | 1592 |
Cytogenetics | 11q21 |
Refseq ORF | 687 |
Synonyms | AD002; C11orf5; Cwf15; HSPC148; ORF5 |
Summary | Involved in pre-mRNA splicing as component of the spliceosome (PubMed:28502770, PubMed:28076346). Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414000 | CWC15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414000 | Transient overexpression lysate of CWC15 spliceosome-associated protein homolog (S. cerevisiae) (CWC15) |
CNY 3080.00 |
|
PH308046 | CWC15 MS Standard C13 and N15-labeled recombinant protein (NP_057487) |
CNY 19520.00 |