USP20 (NM_006676) Human Recombinant Protein
CAT#: TP308051
Recombinant protein of human ubiquitin specific peptidase 20 (USP20), transcript variant 1, 20 µg
View other "USP20" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC208051 protein sequence 
Red=Cloning site Green=Tags(s) MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKH NLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLK PRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVP TSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSE DEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADV DTAMAALDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSY VLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSA IYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCE RCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLS VICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGG PAVNHLYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPG PIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPENLHGEQKIEAET RAV myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 101.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Bioactivity | Pull-down assay (PMID: 26839314) | 
| Reference Data | |
| RefSeq | NP_006667 | 
| Locus ID | 10868 | 
| UniProt ID | Q9Y2K6 | 
| Refseq Size | 4538 | 
| Cytogenetics | 9q34.11 | 
| Refseq ORF | 2739 | 
| Synonyms | hVDU2; LSFR3A; VDU2 | 
| Summary | This gene encodes a ubiquitin specific processing protease that was first identified as a substrate of the VHL (von Hippel-Lindau disease) protein E3 ubiquitin ligase complex. In addition to being ubiquitinated by the VHL-E3 ligase complex, this enzyme deubiquitinates hypoxia-inducible factor (HIF)-1 alpha and thereby causes increased expression of HIF-1alpha targeted genes which play a role in angiogenesis, glucose metabolism, cell proliferation and metastasis. The enzyme encoded by this gene also regulates G-protein coupled receptor signaling by mediating the deubiquitination of beta-2 adrenergic receptor (ADRB2). This enzyme is a ubiquitously expressed thiolester hydrolase. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jan 2013] | 
| Protein Families | Druggable Genome, Protease | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Ubiquitin-specific Protease 20 Regulates the Reciprocal Functions of β-Arrestin2 in Toll-like Receptor 4-promoted Nuclear Factor κB (NFκB) Activation
                                                ,Jean-Charles, P;Zhang, L;Wu, J;Han, S;Brian, L;Freedman, NJ;Shenoy, SK;,
                                                Journal of Biological Chemistry
                                                ,PubMed ID 26839314
                                                [USP20]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402002 | USP20 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC423335 | USP20 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LY402002 | Transient overexpression lysate of ubiquitin specific peptidase 20 (USP20), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY423335 | Transient overexpression lysate of ubiquitin specific peptidase 20 (USP20), transcript variant 2 | 
                                                     CNY 4840.00  | 
                                            |
| PH308051 | USP20 MS Standard C13 and N15-labeled recombinant protein (NP_006667) | 
                                                     CNY 19520.00  | 
                                            
