DMRT1 (NM_021951) Human Recombinant Protein
CAT#: TP308108
Recombinant protein of human doublesex and mab-3 related transcription factor 1 (DMRT1), 20 µg
View other "DMRT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208108 protein sequence
Red=Cloning site Green=Tags(s) MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKS PRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLP SAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYY SSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA VLECEPASEPSSFTVTPVIEEDE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_068770 |
| Locus ID | 1761 |
| UniProt ID | Q9Y5R6 |
| Refseq Size | 2229 |
| Cytogenetics | 9p24.3 |
| Refseq ORF | 1119 |
| Synonyms | CT154; DMT1 |
| Summary | This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411862 | DMRT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411862 | Transient overexpression lysate of doublesex and mab-3 related transcription factor 1 (DMRT1) |
CNY 3080.00 |
|
| PH308108 | DMRT1 MS Standard C13 and N15-labeled recombinant protein (NP_068770) |
CNY 19520.00 |
