DNAAF11 (NM_012472) Human Recombinant Protein
CAT#: TP308256
Recombinant protein of human leucine rich repeat containing 6 (LRRC6), 20 µg
View other "DNAAF11" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208256 protein sequence
Red=Cloning site Green=Tags(s) MGWITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIENVSKLKKLEY LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFLMGNPCASFDHYREFVVATLP QLKWLDGKEIEPSERIKALQDYSVIEPQIREQEKDHCLKRAKLKEEAQRKHQEEDKNEDKRSNAGFDGRW YTDINATLSSLESKDHLQAPDTEEHNTKKLDNSEDDLEFWNKPCLFTPESRLETLRHMEKQRKKQEKLSE KKKKVKPPRTLITEDGKALNVNEPKIDFSLKDNEKQIILDLAVYRYMDTSLIDVDVQPTYVRVMIKGKPF QLVLPAEVKPDSSSAKRSQTTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDP SKHSFPDVTNIVQEKKHTPRRRPEPKIIPSEEDPTFEDNPEVPPLI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036604 |
| Locus ID | 23639 |
| UniProt ID | Q86X45 |
| Refseq Size | 1888 |
| Cytogenetics | 8q24.22 |
| Refseq ORF | 1398 |
| Synonyms | CILD19; LRRC6; LRTP; tilB; TSLRP |
| Summary | The protein encoded by this gene contains several leucine-rich repeat domains and appears to be involved in the motility of cilia. Defects in this gene are a cause of primary ciliary dyskinesia-19 (CILD19). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 11 and 22. [provided by RefSeq, Apr 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415734 | LRRC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415734 | Transient overexpression lysate of leucine rich repeat containing 6 (LRRC6) |
CNY 3080.00 |
|
| PH308256 | LRRC6 MS Standard C13 and N15-labeled recombinant protein (NP_036604) |
CNY 19520.00 |
|
| TP710153 | Recombinant protein of human leucine rich repeat containing 6 (LRRC6), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
其它DNAAF11产品
